PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 899aa    MW: 100632 Da    PI: 5.6945
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39376genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.7e-29582633152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Tp57577_TGAC_v2_mRNA39376 582 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 633
                                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.859572653IPR003035RWP-RK domain
PfamPF020426.3E-25585633IPR003035RWP-RK domain
SuperFamilySSF542771.13E-24796889No hitNo description
Gene3DG3DSA:3.10.20.2404.8E-23802884No hitNo description
PROSITE profilePS5174526.311804887IPR000270PB1 domain
SMARTSM006665.9E-24804887IPR000270PB1 domain
PfamPF005647.0E-19805886IPR000270PB1 domain
CDDcd064072.01E-40805886No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 899 aa     Download sequence    Send to blast
MGDGAAVTSS ATMMEGPPQD ENSMDFDYMS ELLLDGCWLE ASADGSEFLL QSSPFSNPIF  60
DPSFSWPSLE NTEPPRNEDG HVGIEQESQI IVNNAGSSDR QQCEFETRSG EGVSRLWIPP  120
TPNPGPGGSF ITEKLIRALK WIKDFNRNKD MLIQIWVPVN RGDDRPILRA NDLPFSLESR  180
SLNLAKYREI SVRYQFSVEE EDSKELVAGL PGRVYRDKIP EWTPDVRFFR SEEYPRVDHA  240
QECDIHGTLA VPVFEQGSRT CLGVIEVVMT TQQSNYGREL ETVCKALEVV DLRSSGHSSL  300
QNVKACDKSY ETALPEIQEV LRSACEMHKL PLAQTWISCI QQGKDGCRHS DDNYANCISP  360
VEYACYVGDS SVRFFHEACM EHHLLKGQGV AGGAFMTNQP CFSADITSLS KTDYPLSHHA  420
RLFGLRAAVA IRLRSIYSTS DDYVLEFFLP VDCNDSEEQK NMLTSLSMII QRVCRSLRVI  480
TDKELDKDNL PSNEVMAVTD GRFATNAIWS ESQHRRMAAS LGGEEKLSET MSRKFSEQRR  540
QQETLTLKGD LDCGRASSPS VEGTFLSSLG INRTGEKRRA KAEKTITLQV LRQYFAGSLK  600
DAAKNIGVCT TTLKRICRQH GIKRWPSRKI KKVGHSLQKL QLVIDSVQGA SGSFQIDSFY  660
SKFSDLSSPR TSLISTLNQI DNQVSLSTLP DPDSLSPEGA SKSPSSSCSQ SSFSSHSCSS  720
MSEQQHRKGN VAIGNKDPSV GEDSVDVVLK RIRSEAELKS LIQDNKTKLM PRSQSQETLG  780
ENPKTEHHKS FLKSAPKASQ KEDSHRVKVT FGDEKTRFRL PKNWGYEDLV QEIARRFNVS  840
EMSKFDIKYL DDDYEWVLLT CDADLEECID VCQSSETSTI KLCLQPSSNF IRSSLEFR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013462281.10.0plant regulator RWP-RK family protein
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A072V3U80.0A0A072V3U8_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA04G01910.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein